Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MTMR8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 430-560 of human MTMR8 (NP_060147.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MTMR8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 430-560 of human MTMR8 (NP_060147.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-07049A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MTMR8 |
| Target Synonyms | MTMR8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, SKOV3, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 430-560 of human MTMR8 (NP_060147.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HVFSCQFGNFLGNCQKDREDLRVYEKTHSVWPFLVQRKPDFRNPLYKGFTMYGVLNPSTVPYNIQFWCGMYNRFDKGLQPKQSMLESLLEIKKQRAMLETDVHELEKKLKVRDEPPEEICTCSQLGNILSQ | Uniprot ID | Q96EF0 |
Uniprot Id
Q96EF0
Target Species
Human
Target Name
MTMR8
Target Full Name
Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR8
Target Function
Phosphatase that acts on lipids with a phosphoinositol headgroup. Has phosphatase activity towards phosphatidylinositol 3-phosphate and phosphatidylinositol 3,5-bisphosphate. In complex with MTMR9, negatively regulates autophagy.
Target Subcellular Location
Nucleus envelope.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class myotubularin subfamily
Target Synonyms
C8orf9; DKFZP434K171; FLJ20126; LIP STYX; MTMR8; MTMR8_HUMAN; MTMR9; Myotubularin related protein 8; Myotubularin related protein 9; Myotubularin-related protein 8
Target Background
This gene encodes a member of the myotubularin-related family and is part of the MTMR6 subgroup. Family members are dual-specificity phosphatases and the encoded protein contains a phosphoinositide-binding domain (PID) and a SET-interacting domain (SID). Defects in other family members have been found in myotubular myopathic diseases.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
