Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 143-220 of human MYF5 (NP_005584.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 143-220 of human MYF5 (NP_005584.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12011A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYF5 |
| Target Synonyms | EORVA; bHLHc2; MYF5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 143-220 of human MYF5 (NP_005584.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQP | Uniprot ID | P13349 |
Uniprot Id
P13349
Target Species
Human
Target Name
MYF5
Target Full Name
Myogenic factor 5
Target Function
Transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation. Together with MYOG and MYOD1, co-occupies muscle-specific gene promoter core region during myogenesis. Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.
Target Subcellular Location
Nucleus.
Target Synonyms
bHLHc2; Class C basic helix loop helix protein 2; Class C basic helix-loop-helix protein 2; Myf 5; Myf-5; Myf5; MYF5_HUMAN; Myogenic factor 5
Target Background
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to contribute to E-box binding activity. Predicted to be involved in several processes, including muscle cell fate commitment; positive regulation of cell differentiation; and skeletal muscle cell differentiation. Predicted to act upstream of or within several processes, including animal organ development; regulation of cell-matrix adhesion; and somitogenesis. Located in nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
