Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYL12A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 92-171 of human MYL12A (NP_006462.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYL12A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 92-171 of human MYL12A (NP_006462.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08931A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYL12A |
| Target Synonyms | MLCB; MRCL3; MRLC3; MYL2B; MLC-2B; HEL-S-24; MYL12A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A375, Jurkat, K-562, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 92-171 of human MYL12A (NP_006462.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD | Uniprot ID | P19105 |
Uniprot Id
P19105
Target Species
Human
Target Name
MYL12A
Target Full Name
Myosin regulatory light chain 12A
Target Research Area
Signal Transduction
Target Synonyms
ML12A_HUMAN; MLC 2B; MLC-2B; MLCB; MRCL3; MYL12A; Myosin regulatory light chain 12A; Myosin regulatory light chain 2; Myosin regulatory light chain 2, nonsarcomeric; Myosin regulatory light chain MRCL3; Myosin regulatory light chain MRLC3; Myosin RLC; Myosin, light polypeptide, regulatory, non sarcomeric (20kD); nonsarcomeric; RLC
Target Background
This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
