Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYLK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human MYLK2 (NP_149109.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYLK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human MYLK2 (NP_149109.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05742A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYLK2 |
| Target Synonyms | KMLC; MLCK; MLCK2; skMLCK; MYLK2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human MYLK2 (NP_149109.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATENGAVELGIQNPSTDKAPKGPTGERPLAAGKDPGPPDPKKAPDPPTLKKDAKAPASEKGDGTLAQPSTSSQGPKGEGDRGGGPAEGS | Uniprot ID | Q9H1R3 |
Uniprot Id
Q9H1R3
Target Species
Human
Target Name
MYLK2
Target Full Name
Myosin light chain kinase 2, skeletal/cardiac muscle
Target Function
Implicated in the level of global muscle contraction and cardiac function. Phosphorylates a specific serine in the N-terminus of a myosin light chain.
Target Involvement
Cardiomyopathy, familial hypertrophic (CMH)
Target Subcellular Location
Cytoplasm. Note=Colocalizes with phosphorylated myosin light chain (RLCP) at filaments of the myofibrils.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family
Target Tissue Specificity
Heart and skeletal muscles. Increased expression in the apical tissue compared to the interventricular septal tissue.
Target Synonyms
KMLC; MLCK; MLCK, skeletal/cardiac; MLCK2; MYLK 2; MYLK2; MYLK2_HUMAN; Myosin light chain kinase 2; Myosin light chain kinase 2 skeletal muscle; Myosin light chain kinase 2 skeletal/cardiac muscle; MYOSIN LIGHT POLYPEPTIDE KINASE; Myosin light polypeptide kinase, skeletal/cardiac; Skeletal muscle myosin light chain kinase; Skeletal myosin light chain kinase; skeletal/cardiac muscle; skMLCK
Target Background
This gene encodes a myosin light chain kinase, a calcium/calmodulin dependent enzyme, that is exclusively expressed in adult skeletal muscle.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
