Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYOCD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 680-780 of human MYOCD (NP_705832.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MYOCD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 680-780 of human MYOCD (NP_705832.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Immunohistochemistry analysis of MYOCD in paraffin-embedded Rat brain using MYOCD Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-04596A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYOCD |
| Target Synonyms | MGBL; MYCD; MYOCD | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 680-780 of human MYOCD (NP_705832.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SQVCTAQMAGLHSSDKVGPKFSIPSPTFSKSSSAISEVTQPPSYEDAVKQQMTRSQQMDELLDVLIESGEMPADAREDHSCLQKVPKIPRSSRSPTAVLTK | Uniprot ID | Q8IZQ8 |
Uniprot Id
Q8IZQ8
Target Species
Human
Target Name
MYOCD
Target Full Name
Myocardin
Target Function
Smooth muscle cells (SM) and cardiac muscle cells-specific transcriptional factor which uses the canonical single or multiple CArG boxes DNA sequence. Acts as a cofactor of serum response factor (SRF) with the potential to modulate SRF-target genes. Plays a crucial role in cardiogenesis, urinary bladder development, and differentiation of the smooth muscle cell lineage (myogenesis).
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in heart, aorta, and in smooth muscle cell-containing tissues: stomach, bladder, small intestine, colon, lung, placenta and uterus. Very faint expression in prostate and skeletal muscle.
Target Synonyms
MYCD; MYCD_HUMAN; Myocardin; Myocd
Target Background
This gene encodes a nuclear protein, which is expressed in heart, aorta, and in smooth muscle cell-containing tissues. It functions as a transcriptional co-activator of serum response factor (SRF) and modulates expression of cardiac and smooth muscle-specific SRF-target genes, and thus may play a crucial role in cardiogenesis and differentiation of the smooth muscle cell lineage. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
