-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NAB2 (NP_005958.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NAB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NAB2 (NP_005958.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09640A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAB2 |
| Target Synonyms | MADER; NAB2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | M21, Mouse liver, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human NAB2 (NP_005958.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGE | Uniprot ID | Q15742 |
Uniprot Id
Q15742
Target Species
Human
Target Name
NAB2
Target Full Name
NGFI-A-binding protein 2
Target Function
Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2. Isoform 2 lacks repression ability.
Target Subcellular Location
Nucleus.
Target Protein Families
NAB family
Target Tissue Specificity
Widely expressed at low levels. Highly expressed in melanoma cell lines.
Target Synonyms
EGR 1 binding protein 2; EGR-1-binding protein 2; EGR1 binding protein 2; MADER; Melanoma associated delayed early response protein; Melanoma-associated delayed early response protein; MGC75085; Nab 2; nab2; NAB2_HUMAN; NGFI A binding protein 2 (EGR1 binding protein 2); NGFI A binding protein 2; NGFI-A-binding protein 2; Protein MADER
Target Background
This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Notification