Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAV2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1800-1980 of human NAV2 (NP_660093.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against NAV2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1800-1980 of human NAV2 (NP_660093.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06685A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAV2 |
| Target Synonyms | HELAD1; RAINB1; POMFIL2; UNC53H2; STEERIN2; NAV2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, HepG2, MCF-7 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1800-1980 of human NAV2 (NP_660093.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEMTDSSLPSSPKLPHNGSTGSTPLLRNSHSNSLISECMDSEAETVMQLRNELRDKEMKLTDIRLEALSSAHQLDQLREAMNRMQSEIEKLKAENDRLKSESQGSGCSRAPSQVSISASPRQSMGLSQHSLNLTESTSLDMLLDDTGECSARKEGGRHVKIVVSFQEEMKWKEDSRPHLFL | Uniprot ID | Q8IVL1 |
Uniprot Id
Q8IVL1
Target Species
Human
Target Name
NAV2
Target Full Name
Neuron navigator 2
Target Function
Possesses 3' to 5' helicase activity and exonuclease activity. Involved in neuronal development, specifically in the development of different sensory organs.
Target Subcellular Location
Nucleus.
Target Protein Families
Nav/unc-53 family
Target Tissue Specificity
Highly expressed in the brain, kidney and liver. Also expressed in the thyroid, mammary gland, spinal cord, heart, placenta and lung. Abundantly expressed in colon cancers.
Target Research Area
Cancer
Target Synonyms
NAV2; HELAD1; KIAA1419; POMFIL2; RAINB1; STEERIN2Neuron navigator 2; EC 3.6.4.12; Helicase APC down-regulated 1; Pore membrane and/or filament-interacting-like protein 2; Retinoic acid inducible in neuroblastoma 1; Steerin-2; Unc-53 homolog 2; unc53H2
Target Background
This gene encodes a member of the neuron navigator gene family, which may play a role in cellular growth and migration. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
