Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFA4L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human NDUFA4L2 (NP_064527.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NDUFA4L2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human NDUFA4L2 (NP_064527.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10221A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFA4L2 |
| Target Synonyms | NUOMS; MISTRH; COXFA4L2; NDUFA4L2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, 293T, HepG2, Jurkat, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human NDUFA4L2 (NP_064527.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF | Uniprot ID | Q9NRX3 |
Uniprot Id
Q9NRX3
Target Species
Human
Target Name
NDUFA4L2
Target Full Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2
Target Synonyms
FLJ26118; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 4 like 2; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2; NADH ubiquinone oxidoreductase MLRQ subunit homolog; NADH-ubiquinone oxidoreductase MLRQ subunit homolog; Ndufa4l2; NUA4L_HUMAN; NUOMS
Target Background
Predicted to be integral component of membrane. Predicted to be part of mitochondrial respiratory chain complex IV.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
