Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-154 of human NDUFA6 (NP_002481.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDUFA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-154 of human NDUFA6 (NP_002481.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00910A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFA6 |
| Target Synonyms | B14; LYRM6; CI-B14; MC1DN33; NADHB14; NDUFA6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, 22Rv1, HepG2, Raji, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 35-154 of human NDUFA6 (NP_002481.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP | Uniprot ID | P56556 |
Uniprot Id
P56556
Target Species
Human
Target Name
NDUFA6
Target Full Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Required for proper complex I assembly. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
Complex I LYR family
Target Research Area
Transport
Target Synonyms
B14; CI-B14; complex I B14 subunit; Complex I-B14; LYR motif-containing protein 6; LYRM6; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6 (14kD, B14); NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6, 14kDa; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6; NADH-ubiquinone oxidoreductase 1 alpha subcomplex, 6; NADH-ubiquinone oxidoreductase B14 subunit; NADHB14; NDUA6_HUMAN; NDUFA6
Target Background
This gene encodes a member of the LYR family of proteins that contain a highly conserved tripeptide (LYR) motif near the N-terminus. The encoded protein is an accessory subunit of NADH: ubiquinone oxidorerductase (Complex I), which is the largest enzyme of the mitochondrial membrane respiratory chain. Complex I functions in electron transfer from NADH to the respiratory chain.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
