Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFA8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 33-172 of human NDUFA8 (NP_055037.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against NDUFA8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 33-172 of human NDUFA8 (NP_055037.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-11758A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFA8 |
| Target Synonyms | PGIV; CI-19KD; CI-PGIV; MC1DN37; NDUFA8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, 293T, LO2, MCF7, Mouse brain | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 33-172 of human NDUFA8 (NP_055037.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK | Uniprot ID | P51970 |
Uniprot Id
P51970
Target Species
Human
Target Name
NDUFA8
Target Full Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein. Mitochondrion intermembrane space. Mitochondrion.
Target Protein Families
Complex I NDUFA8 subunit family
Target Synonyms
CI 19KD; CI PGIV; CI-19kD; CI-PGIV; Complex I 19k; Complex I 19kD; Complex I PGIV; Complex I PGIV subunit; Complex I-19kD; Complex I-PGIV; MGC793; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 8 (19kD PGIV); NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 8 19kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 8; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8; NADH ubiquinone oxidoreductase 19 kDa subunit; NADH ubiquinone oxidoreductase PGIV subunit ; NADH-ubiquinone oxidoreductase 19 kDa subunit; NDUA8_HUMAN; NDUFA 8; NDUFA8; OTTHUMP00000022034; PGIV
Target Background
The protein encoded by this gene belongs to the complex I 19 kDa subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
