Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFAB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-156 of human NDUFAB1 (NP_004994.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDUFAB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-156 of human NDUFAB1 (NP_004994.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07928A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFAB1 |
| Target Synonyms | ACP; ACP1; SDAP; FASN2A; NDUFAB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, 293F, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-156 of human NDUFAB1 (NP_004994.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE | Uniprot ID | O14561 |
Uniprot Id
O14561
Target Species
Human
Target Name
NDUFAB1
Target Full Name
Acyl carrier protein, mitochondrial
Target Function
Carrier of the growing fatty acid chain in fatty acid biosynthesis. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain.
Target Subcellular Location
Mitochondrion.
Target Protein Families
Acyl carrier protein (ACP) family
Target Synonyms
ACP; ACPM_HUMAN; Acyl carrier protein; Acyl carrier protein mitochondrial; CI SDAP; CI-SDAP; FASN 2A; FASN2A; MGC65095; Mitochondrial acyl carrier protein; mitochondrial; NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1 8kDa; NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1; NADH ubiquinone oxidoreductase 9.6 kDa subunit; NADH ubiquinone oxidoreductase SDAP subunit; NADH-ubiquinone oxidoreductase 9.6 kDa subunit; NDUFAB 1; ndufab1; SDAP
Target Background
Predicted to enable acyl binding activity; acyl carrier activity; and fatty acid binding activity. Involved in mitochondrial respiratory chain complex I assembly and protein lipoylation. Located in mitochondrion and nucleoplasm. Part of mitochondrial respiratory chain complex I. Colocalizes with mitochondrial large ribosomal subunit.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
