-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFAF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-169 of human NDUFAF2 (NP_777549.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NDUFAF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-169 of human NDUFAF2 (NP_777549.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05743A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFAF2 |
| Target Synonyms | MMTN; B17.2L; MC1DN10; mimitin; NDUFA12L; NDUFAF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, HepG2, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-169 of human NDUFAF2 (NP_777549.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ | Uniprot ID | Q8N183 |
Uniprot Id
Q8N183
Target Species
Human
Target Name
NDUFAF2
Target Full Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2
Target Function
Acts as a molecular chaperone for mitochondrial complex I assembly. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Involvement
Mitochondrial complex I deficiency (MT-C1D); Leigh syndrome (LS)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Complex I NDUFA12 subunit family
Target Tissue Specificity
Highly expressed in ESCC cells. Also expressed in heart, skeletal muscle, liver, and in fibroblasts.
Target Synonyms
B17.2 like; B17.2-like; B17.2L; FLJ22398; MIMIT_HUMAN; Mimitin; Mimitin mitochondrial ; mitochondrial; MMTN; Myc induced mitochondrial protein; Myc-induced mitochondrial protein; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex assembly factor 2; NADH dehydrogenase (ubiquinone) complex I; assembly factor 2; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2; NDUFA12 like; NDUFA12 like protein ; NDUFA12-like protein; NDUFA12L; NDUFAF2; OTTHUMP00000161882; OTTHUMP00000221703
Target Background
NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency.
Notification