Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NDUFB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 34-105 of human NDUFB2 (NP_004537.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NDUFB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 34-105 of human NDUFB2 (NP_004537.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08795A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NDUFB2 |
| Target Synonyms | AGGG; CI-AGGG; NDUFB2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, 293T, Mouse brain, Mouse liver, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 34-105 of human NDUFB2 (NP_004537.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED | Uniprot ID | O95178 |
Uniprot Id
O95178
Target Species
Human
Target Name
NDUFB2
Target Full Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial
Target Function
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
Complex I NDUFB2 subunit family
Target Synonyms
CI-AGGG; Complex I-AGGG; mitochondrial; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2; NADH-ubiquinone oxidoreductase AGGG subunit; NDUB2_HUMAN; NDUFB2
Target Background
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays a important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Hydropathy analysis revealed that this subunit and 4 other subunits have an overall hydrophilic pattern, even though they are found within the hydrophobic protein (HP) fraction of complex I.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
