Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NEURL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 181-285 of human NEURL2 (NP_542787.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NEURL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 181-285 of human NEURL2 (NP_542787.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05633A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NEURL2 |
| Target Synonyms | OZZ; OZZ-E3; C20orf163; NEURL2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, Mouse brain, Mouse skeletal muscle, Rat skeletal muscle, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 181-285 of human NEURL2 (NP_542787.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LPPTARRSRLGVLFCPRPDGTADMHIIINGEDMGPSARGLPAAQPLYAVVDVFASTKSVRLVQLEYGLPSLQTLCRLVIQRSMVHRLAIDGLHLPKELKDFCKYE | Uniprot ID | Q9BR09 |
Uniprot Id
Q9BR09
Target Species
Human
Target Name
NEURL2
Target Full Name
Neuralized-like protein 2
Target Function
Plays an important role in the process of myofiber differentiation and maturation. Probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex, which mediates the ubiquitination of proteins. Probably contributes to catalysis through recognition and positioning of the substrate and the ubiquitin-conjugating enzyme. During myogenesis, controls the ubiquitination and degradation of the specific pool of CTNNB1/beta-catenin located at the sarcolemma.
Target Subcellular Location
Cytoplasm.
Target Tissue Specificity
Expressed specifically in skeletal and cardiac muscles.
Target Synonyms
NEURL2; C20orf163; Neuralized-like protein 2
Target Background
This gene encodes a protein that is involved in the regulation of myofibril organization. This protein is likely the adaptor component of the E3 ubiquitin ligase complex in striated muscle, and it regulates the ubiquitin-mediated degradation of beta-catenin during myogenesis. Alternative splicing of this gene results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
