Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NEUROD6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 188-337 of human NEUROD6 (NP_073565.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NEUROD6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 188-337 of human NEUROD6 (NP_073565.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04771A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NEUROD6 |
| Target Synonyms | Nex1; Atoh2; MATH2; NEX1M; Math-2; bHLHa2; NEUROD6 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 188-337 of human NEUROD6 (NP_073565.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN | Uniprot ID | Q96NK8 |
Uniprot Id
Q96NK8
Target Species
Human
Target Name
NEUROD6
Target Full Name
Neurogenic differentiation factor 6
Target Function
Activates E box-dependent transcription in collaboration with TCF3/E47. May be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. Transactivates the promoter of its own gene.
Target Subcellular Location
Nucleus.
Target Synonyms
Atoh 2; Atoh2; Atonal homolog 2; Atonal protein homolog 2; Atonal protein homolog2; bHLH a2; bHLHa 2; bHLHa2; Class A basic helix-loop-helix protein 2; Helix loop helix protein mATH 2; Helix loop helix protein mATH2; MATH 2; Math2; NDF 6; NDF6; NDF6_HUMAN; Neuro D6; NeuroD6; Neurogenic differentiation 6; Neurogenic differentiation factor 6; Nex 1; Nex 1m; Nex; Nex1; Nex1 m; Nex1m; Protein atonal homolog 2; Protein atonal homolog2
Target Background
This gene is a member of the NEUROD family of basic helix-loop-helix transcription factors. The encoded protein may be involved in the development and differentiation of the nervous system.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
