-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NFAT5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1355-1455 of human NFAT5 (NP_619728.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NFAT5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1355-1455 of human NFAT5 (NP_619728.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00152A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NFAT5 |
| Target Synonyms | NFATZ; OREBP; NF-AT5; NFATL1; TONEBP; NFAT5 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1355-1455 of human NFAT5 (NP_619728.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF | Uniprot ID | O94916 |
Uniprot Id
O94916
Target Species
Human
Target Name
NFAT5
Target Full Name
Nuclear factor of activated T-cells 5
Target Function
Transcription factor involved, among others, in the transcriptional regulation of osmoprotective and inflammatory genes. Mediates the transcriptional response to hypertonicity. Positively regulates the transcription of LCN2 and S100A4 genes; optimal transactivation of these genes requires the presence of DDX5/DDX17. Binds the DNA consensus sequence 5'-[ACT][AG]TGGAAA[CAT]A[TA][ATC][CA][ATG][GT][GAC][CG][CT]-3'.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Tissue Specificity
Widely expressed, with highest levels in skeletal muscle, brain, heart and peripheral blood leukocytes.
Target Synonyms
Glutamine rich protein H65; KIAA0827; NF AT5; NF-AT5; NFAT 5; NFAT L1; NFAT like protein 1; NFAT5; NFAT5_HUMAN; NFATL 1; NFATL1; NFATZ; Nuclear factor of activated T cells 5; Nuclear factor of activated T cells 5 tonicity responsive; Nuclear factor of activated T cells; Nuclear factor of activated T-cells 5; OREBP; Osmotic response element binding protein; T cell transcription factor NFAT 5; T cell transcription factor NFAT5; T-cell transcription factor NFAT5; TonE binding protein; TonE-binding protein; TonEBP; Tonicity responsive enhancer binding protein; Tonicity-responsive enhancer-binding protein
Target Background
The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification