Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NHP2L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human NHP2L1 (NP_004999.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NHP2L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human NHP2L1 (NP_004999.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03622A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NHP2L1 |
| Target Synonyms | FA1; FA-1; NHPX; 15.5K; OTK27; SSFA1; NHP2L1; SPAG12; SNRNP15-5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human NHP2L1 (NP_004999.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV | Uniprot ID | P55769 |
Uniprot Id
P55769
Target Species
Human
Target Name
SNU13
Target Full Name
NHP2-like protein 1
Target Function
Involved in pre-mRNA splicing as component of the spliceosome. Binds to the 5'-stem-loop of U4 snRNA and thereby contributes to spliceosome assembly. The protein undergoes a conformational change upon RNA-binding.
Target Subcellular Location
Nucleus. Nucleus, nucleolus.
Target Protein Families
Eukaryotic ribosomal protein eL8 family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Transcription
Target Synonyms
SNU13; NHP2L1; NHP2-like protein 1; High mobility group-like nuclear protein 2 homolog 1; OTK27; SNU13 homolog; hSNU13; U4/U6.U5 small nuclear ribonucleoprotein SNU13; U4/U6.U5 tri-snRNP 15.5 kDa protein) [Cleaved into: NHP2-like protein 1; N-terminally processed]
Target Background
Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
