Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NIFK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human NIFK (NP_115766.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NIFK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human NIFK (NP_115766.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08822A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NIFK |
| Target Synonyms | Nopp34; MKI67IP; NIFK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Jurkat, Mouse liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-260 of human NIFK (NP_115766.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDE | Uniprot ID | Q9BYG3 |
Uniprot Id
Q9BYG3
Target Species
Human
Target Name
NIFK
Target Full Name
MKI67 FHA domain-interacting nucleolar phosphoprotein
Target Subcellular Location
Nucleus, nucleolus. Chromosome. Note=Localizes to mitotic chromosomes in conjunction with MKI67.
Target Synonyms
hNIFK; MK67I_HUMAN; MKI67 FHA Domain Interacting Nucleolar Phosphoprotein; MKI67 FHA domain-interacting nucleolar phosphoprotein; mki67ip; NOPP34; Nucleolar phosphoprotein Nopp34; Nucleolar protein interacting with the FHA domain of pKI 67; Nucleolar protein interacting with the FHA domain of pKI-67; pKi67
Target Background
This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
