Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NKX2-2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 102-201 of human NKX2-2(NP_002500.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NKX2-2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 102-201 of human NKX2-2(NP_002500.1?) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08490A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Nkx2-2 |
| Target Synonyms | NKX2B; NKX2.2; NKX2-2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T cells transfected with NKX2-2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 102-201 of human NKX2-2(NP_002500.1?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPR | Uniprot ID | O95096 |
Uniprot Id
O95096
Target Species
Human
Target Name
NKX2-2
Target Full Name
Homeobox protein Nkx-2.2
Target Function
Transcriptional activator involved in the development of insulin-producting beta cells in the endocrine pancreas. May also be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Binds to elements within the NEUROD1 promoter.
Target Subcellular Location
Nucleus.
Target Protein Families
NK-2 homeobox family
Target Synonyms
Homeobox protein NK 2 homolog B; Homeobox protein NK-2 homolog B; Homeobox protein Nkx 2.2; Homeobox protein Nkx-2.2; NK 2 homolog B; NK2 homeobox 2; NK2 transcription factor like protein B; NK2 transcription factor related locus 2; NKX2 2; NKX2-2; NKX22; NKX22_HUMAN; Nkx2b; tinman
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
