-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NLGN4X was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 697-816 of human NLGN4X (NP_065793.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NLGN4X was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 697-816 of human NLGN4X (NP_065793.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09159A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NLGN4X |
| Target Synonyms | HLNX; HNL4X; NLGN4; ASPGX2; AUTSX2; NLGN4X | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BT-474, Mouse brain, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 697-816 of human NLGN4X (NP_065793.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YYKKDKRRHETHRRPSPQRNTTNDIAHIQNEEIMSLQMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPLMTPNTITMIPNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV | Uniprot ID | Q8N0W4 |
Uniprot Id
Q8N0W4
Target Species
Human
Target Name
NLGN4X
Target Full Name
Neuroligin-4, X-linked
Target Function
Putative neuronal cell surface protein involved in cell-cell-interactions.
Target Involvement
Autism, X-linked 2 (AUTSX2); Asperger syndrome, X-linked, 2 (ASPGX2)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, synapse, postsynaptic density membrane.
Target Protein Families
Type-B carboxylesterase/lipase family
Target Tissue Specificity
Expressed at highest levels in heart. Expressed at lower levels in liver, skeletal muscle and pancreas and at very low levels in brain.
Target Synonyms
ASPGX2; AUTSX2; HLNX; HNL4X; HNLX; KIAA1260; neuroligin 4, X-linked; Neuroligin X; Neuroligin-4; NL4; NLGN; NLGN4; NLGN4X; NLGNX_HUMAN; OTTHUMP00000022863; OTTHUMP00000022864; OTTHUMP00000022865; X-linked
Target Background
This gene encodes a member of the type-B carboxylesterase/lipase protein family. The encoded protein belongs to a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs large homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Alternative splicing results in multiple transcript variants.
Notification