Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NMT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human NMT2 (NP_004799.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NMT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human NMT2 (NP_004799.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02721A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NMT2 |
| Target Synonyms | NMT2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse testis, Raji, SW480 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human NMT2 (NP_004799.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPNSGGTKSDSASDSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQ | Uniprot ID | O60551 |
Uniprot Id
O60551
Target Species
Human
Target Name
NMT2
Target Full Name
Glycylpeptide N-tetradecanoyltransferase 2
Target Function
Adds a myristoyl group to the N-terminal glycine residue of certain cellular and viral proteins.
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein.
Target Protein Families
NMT family
Target Synonyms
EC 2.3.1.97; Glycylpeptide N tetradecanoyltransferase 2; Glycylpeptide N-tetradecanoyltransferase 2; Myristoyl CoA:protein N myristoyltransferase 2; Myristoyl-CoA:protein N-myristoyltransferase 2; N-myristoyltransferase 2; NMT 2; NMT2; NMT2_HUMAN; Peptide N myristoyltransferase 2; Peptide N-myristoyltransferase 2; Type II N myristoyltransferase ; Type II N-myristoyltransferase
Target Background
This gene encodes one of two N-myristoyltransferase proteins. N-terminal myristoylation is a lipid modification that is involved in regulating the function and localization of signaling proteins. The encoded protein catalyzes the addition of a myristoyl group to the N-terminal glycine residue of many signaling proteins, including the human immunodeficiency virus type 1 (HIV-1) proteins, Gag and Nef. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
