-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NMU was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 35-174 of human NMU (NP_006672.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NMU was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 35-174 of human NMU (NP_006672.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02703A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NMU |
| Target Synonyms | NMU | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse large intestine, Mouse stomach, Rat large intestine, Rat stomach | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 35-174 of human NMU (NP_006672.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI | Uniprot ID | P48645 |
Uniprot Id
P48645
Target Species
Human
Target Name
NMU
Target Full Name
Neuromedin-U
Target Function
Ligand for receptors NMUR1 and NMUR2. Stimulates muscle contractions of specific regions of the gastrointestinal tract. In humans, NmU stimulates contractions of the ileum and urinary bladder.; Does not function as a ligand for either NMUR1 or NMUR2. Indirectly induces prolactin release although its potency is much lower than that of neuromedin precursor-related peptide 36.; Does not function as a ligand for either NMUR1 or NMUR2. Indirectly induces prolactin release from lactotroph cells in the pituitary gland, probably via the hypothalamic dopaminergic system.
Target Subcellular Location
Secreted.
Target Protein Families
NmU family
Target Tissue Specificity
Expressed throughout the enteric nervous system with highest levels being found in the jejunum.
Target Synonyms
Neuromedin U 25; Neuromedin U; Neuromedin-U-25; NmU 25; NMU; NmU-25; NMU_HUMAN
Target Background
This gene encodes a member of the neuromedin family of neuropeptides. The encoded protein is a precursor that is proteolytically processed to generate a biologically active neuropeptide that plays a role in pain, stress, immune-mediated inflammatory diseases and feeding regulation. Increased expression of this gene was observed in renal, pancreatic and lung cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. Some of these isoforms may undergo similar processing to generate the mature peptide.
Notification