-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human NOS1 (NP_000611.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NOS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human NOS1 (NP_000611.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11138A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOS1 |
| Target Synonyms | NOS; bNOS; nNOS; IHPS1; N-NOS; NC-NOS; NOS1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human NOS1 (NP_000611.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNGRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAP | Uniprot ID | P29475 |
Uniprot Id
P29475
Target Species
Human
Target Name
NOS1
Target Full Name
Nitric oxide synthase 1
Target Function
Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter. Probably has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such SRR.
Target Subcellular Location
Cell membrane, sarcolemma; Peripheral membrane protein. Cell projection, dendritic spine.
Target Protein Families
NOS family
Target Tissue Specificity
Isoform 1 is ubiquitously expressed: detected in skeletal muscle and brain, also in testis, lung and kidney, and at low levels in heart, adrenal gland and retina. Not detected in the platelets. Isoform 3 is expressed only in testis. Isoform 4 is detected
Target Synonyms
2310005C01Rik; BNOS; Constitutive NOS; EC 1.14.13.39 ; IHPS 1; IHPS1 ; N-NOS; NC-NOS; neuronal Nitric Oxide Synthase; Neuronal NOS; Nitric oxide synthase ; neuronal; included; Nitric oxide synthase 1 (neuronal); Nitric oxide synthase 1; Nitric oxide synthase; brain; Nitric oxide synthase; penile neuronal; included; NNOS; NO; NOS 1; NOS; NOS type I; NOS-I; NOS1; NOS1_HUMAN; Peptidyl-cysteine S-nitrosylase NOS1
Target Background
The protein encoded by this gene belongs to the family of nitric oxide synthases, which synthesize nitric oxide from L-arginine. Nitric oxide is a reactive free radical, which acts as a biologic mediator in several processes, including neurotransmission, and antimicrobial and antitumoral activities. In the brain and peripheral nervous system, nitric oxide displays many properties of a neurotransmitter, and has been implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. This protein is ubiquitously expressed, with high level of expression in skeletal muscle. Multiple transcript variants that differ in the 5' UTR have been described for this gene but the full-length nature of these transcripts is not known. Additionally, alternatively spliced transcript variants encoding different isoforms (some testis-specific) have been found for this gene.
Notification