Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOSTRIN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-430 of human NOSTRIN (NP_001034813.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NOSTRIN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-430 of human NOSTRIN (NP_001034813.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04731A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOSTRIN |
| Target Synonyms | DaIP2; NOSTRIN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Mouse brain, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 270-430 of human NOSTRIN (NP_001034813.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILSTENKSEFLLTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMDENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASSGGQSNPGSST | Uniprot ID | Q8IVI9 |
Uniprot Id
Q8IVI9
Target Species
Human
Target Name
NOSTRIN
Target Full Name
Nostrin
Target Function
Multivalent adapter protein which may decrease NOS3 activity by inducing its translocation away from the plasma membrane.
Target Subcellular Location
[Isoform 1]: Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle. Cytoplasm, cytoskeleton. Note=Enriched in selected actin structures (PubMed:16234328, PubMed:16376344).; [Isoform 3]: Nucleus.
Target Tissue Specificity
Expressed at highest levels in heart, kidney, placenta and lung, and at lowest levels in brain, thymus and spleen. Present in vascular endothelial cells and placenta. Over-expressed in placenta from women with pre-eclampsia (at protein level).
Target Synonyms
BM247; BM247 homolog; DaIP2; eNOS-trafficking inducer; mDaIP2; MGC20702; Nitric oxide synthase traffic inducer; Nitric oxide synthase trafficker; NOSTN_HUMAN; Nostrin; RP23-431D4.2
Target Background
Nitric oxide (NO) is a potent mediator in biologic processes such as neurotransmission, inflammatory response, and vascular homeostasis. NOSTRIN binds the enzyme responsible for NO production, endothelial NO synthase (ENOS; MIM 163729), and triggers the translocation of ENOS from the plasma membrane to vesicle-like subcellular structures, thereby attenuating ENOS-dependent NO production.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
