-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Notch1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human Notch1 (NP_060087.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against Notch1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human Notch1 (NP_060087.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-07742A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOTCH1 |
| Target Synonyms | hN1; AOS5; TAN1; AOVD1; Notch1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human Notch1 (NP_060087.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK | Uniprot ID | P46531 |
Uniprot Id
P46531
Target Species
Human
Target Name
NOTCH1
Target Full Name
Neurogenic locus notch homolog protein 1
Target Function
Functions as a receptor for membrane-bound ligands Jagged-1 (JAG1), Jagged-2 (JAG2) and Delta-1 (DLL1) to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs. Involved in angiogenesis; negatively regulates endothelial cell proliferation and migration and angiogenic sprouting. Involved in the maturation of both CD4(+) and CD8(+) cells in the thymus. Important for follicular differentiation and possibly cell fate selection within the follicle. During cerebellar development, functions as a receptor for neuronal DNER and is involved in the differentiation of Bergmann glia. Represses neuronal and myogenic differentiation. May play an essential role in postimplantation development, probably in some aspect of cell specification and/or differentiation. May be involved in mesoderm development, somite formation and neurogenesis. May enhance HIF1A function by sequestering HIF1AN away from HIF1A. Required for the THBS4 function in regulating protective astrogenesis from the subventricular zone (SVZ) niche after injury. Involved in determination of left/right symmetry by modulating the balance between motile and immotile (sensory) cilia at the left-right organiser (LRO).
Target Involvement
Aortic valve disease 1 (AOVD1); Adams-Oliver syndrome 5 (AOS5)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Notch 1 intracellular domain]: Nucleus.
Target Protein Families
NOTCH family
Target Tissue Specificity
In fetal tissues most abundant in spleen, brain stem and lung. Also present in most adult tissues where it is found mainly in lymphoid tissues.
Target Research Area
Cardiovascular
Target Synonyms
hN1; Neurogenic locus Notch homolog protein 1; NICD; NOTC1_HUMAN; Notch 1; Notch 1 intracellular domain; Notch homolog 1 translocation associated; notch1; TAN1; Translocation associated Notch protein TAN1; Translocation-associated notch protein TAN-1
Target Background
This gene encodes a member of the NOTCH family of proteins. Members of this Type I transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple different domain types. Notch signaling is an evolutionarily conserved intercellular signaling pathway that regulates interactions between physically adjacent cells through binding of Notch family receptors to their cognate ligands. The encoded preproprotein is proteolytically processed in the trans-Golgi network to generate two polypeptide chains that heterodimerize to form the mature cell-surface receptor. This receptor plays a role in the development of numerous cell and tissue types. Mutations in this gene are associated with aortic valve disease, Adams-Oliver syndrome, T-cell acute lymphoblastic leukemia, chronic lymphocytic leukemia, and head and neck squamous cell carcinoma.
Notification