-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOXA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-300 of human NOXA1 (NP_006638.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NOXA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-300 of human NOXA1 (NP_006638.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11450A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOXA1 |
| Target Synonyms | p51NOX; NY-CO-31; SDCCAG31; NOXA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BxPC-3, DU145, HepG2, HT-29, Mouse lung, Mouse small intestine, Mouse stomach | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-300 of human NOXA1 (NP_006638.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EAASSLREAMSKWPEGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPRAGTHQGPLDAETEVGADRCTSTAYQEQRPQVEQVGKQAPLSPGLPAMGGPGPGPCEDPA | Uniprot ID | Q86UR1 |
Uniprot Id
Q86UR1
Target Species
Human
Target Name
NOXA1
Target Full Name
NADPH oxidase activator 1
Target Function
Functions as an activator of NOX1, a superoxide-producing NADPH oxidase. Functions in the production of reactive oxygen species (ROS) which participate in a variety of biological processes including host defense, hormone biosynthesis, oxygen sensing and signal transduction. May also activate CYBB/gp91phox and NOX3.
Target Subcellular Location
Cytoplasm. Cell membrane. Note=Translocation to membranes depends on NOXO1 or NCF1 and maybe RAC1.
Target Protein Families
NCF2/NOXA1 family
Target Tissue Specificity
Widely expressed. Detected in pancreas, liver, kidney, spleen, prostate, small intestine and colon.
Target Synonyms
Antigen NY CO 31; Antigen NY-CO-31; FLJ25475; Inhibitory NADPH oxidase activator 1; MGC131800; NADPH oxidase activator 1; NCF2 like protein; NCF2-like protein; NOX activator 1; NOXA 1; Noxa1; NOXA1_HUMAN; NY CO 31; p51 nox; p51-nox; p51NOX; P67phox like factor; P67phox-like factor; SDCCAG31; Serologically defined colon cancer antigen 31
Target Background
This gene encodes a protein which activates NADPH oxidases, enzymes which catalyze a reaction generating reactive oxygen species. The encoded protein contains four N-terminal tetratricopeptide domains and a C-terminal Src homology 3 domain. Interaction between the encoded protein and proteins in the oxidase regulatory complex occur via the tetratricopeptide domains. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification