-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NPHP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1247-1426 of human NPHP4 (NP_055917.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NPHP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1247-1426 of human NPHP4 (NP_055917.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01080A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NPHP4 |
| Target Synonyms | POC10; SLSN4; NPHP4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1247-1426 of human NPHP4 (NP_055917.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLSLVLRGTQTVRKVRAFTSHPQELKTDPKGVFVLPPRGVQDLHVGVRPLRAGSRFVHLNLVDVDCHQLVASWLVCLCCRQPLISKAFEIMLAAGEGKGVNKRITYTNPYPSRRTFHLHSDHPELLRFREDSFQVGGGETYTIGLQFAPSQRVGEEEILIYINDHEDKNEEAFCVKVIYQ | Uniprot ID | O75161 |
Uniprot Id
O75161
Target Species
Human
Target Name
NPHP4
Target Full Name
Nephrocystin-4
Target Function
Involved in the organization of apical junctions; the function is proposed to implicate a NPHP1-4-8 module. Does not seem to be strictly required for ciliogenesis. Required for building functional cilia. Involved in the organization of the subapical actin network in multiciliated epithelial cells. Seems to recruit INT to basal bodies of motile cilia which subsequently interacts with actin-modifying proteins such as DAAM1. In cooperation with INVS may downregulate the canonical Wnt pathway and promote the Wnt-PCP pathway by regulating expression and subcellular location of disheveled proteins. Stabilizes protein levels of JADE1 and promotes its translocation to the nucleus leading to cooperative inhibition of canonical Wnt signaling. Acts as negative regulator of the hippo pathway by association with LATS1 and modifying LATS1-dependent phosphorylation and localization of WWTR1/TAZ.
Target Involvement
Nephronophthisis 4 (NPHP4); Senior-Loken syndrome 4 (SLSN4)
Target Subcellular Location
Cytoplasm, cytoskeleton, cilium basal body. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cell junction, tight junction. Nucleus.
Target Protein Families
NPHP4 family
Target Tissue Specificity
Expressed in kidney, skeletal muscle, heart and liver, and to a lesser extent in brain and lung.
Target Synonyms
KIAA0673; Nephrocystin-4; nephronophthisis 4; Nephroretinin; NPHP4; NPHP4_HUMAN; POC10; POC10 centriolar protein homolog; SLSN4
Target Background
This gene encodes a protein involved in renal tubular development and function. This protein interacts with nephrocystin, and belongs to a multifunctional complex that is localized to actin- and microtubule-based structures. Mutations in this gene are associated with nephronophthisis type 4, a renal disease, and with Senior-Loken syndrome type 4, a combination of nephronophthisis and retinitis pigmentosa. Alternative splicing results in multiple transcript variants.
Notification