-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NR2C2 / TR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-555 of human NR2C2 / TR4 (NP_003289.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NR2C2 / TR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 460-555 of human NR2C2 / TR4 (NP_003289.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15371A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NR2C2 / TR4 |
| Target Synonyms | TR4; TAK1; NR2C2 / TR4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, NIH/3T3, COS-7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 460-555 of human NR2C2 / TR4 (NP_003289.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSGDRIKQVMEHIWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPGLTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRLARILVRLPALRLMSS | Uniprot ID | P49116 |
Uniprot Id
P49116
Target Species
Human
Target Name
NR2C2
Target Full Name
Nuclear receptor subfamily 2 group C member 2
Target Function
Orphan nuclear receptor that can act as a repressor or activator of transcription. An important repressor of nuclear receptor signaling pathways such as retinoic acid receptor, retinoid X, vitamin D3 receptor, thyroid hormone receptor and estrogen receptor pathways. May regulate gene expression during the late phase of spermatogenesis. Together with NR2C1, forms the core of the DRED (direct repeat erythroid-definitive) complex that represses embryonic and fetal globin transcription including that of GATA1. Binds to hormone response elements (HREs) consisting of two 5'-AGGTCA-3' half site direct repeat consensus sequences. Plays a fundamental role in early embryonic development and embryonic stem cells. Required for normal spermatogenesis and cerebellum development. Appears to be important for neurodevelopmentally regulated behavior. Activates transcriptional activity of LHCG. Antagonist of PPARA-mediated transactivation.
Target Subcellular Location
Nucleus.
Target Protein Families
Nuclear hormone receptor family, NR2 subfamily
Target Research Area
Developmental Biology
Target Synonyms
hTAK1; Nr2c2; NR2C2_HUMAN; Nuclear hormone receptor TR4; Nuclear receptor subfamily 2 group C member 2; Orphan nuclear receptor TAK1; Orphan nuclear receptor TR4; TAK1; Testicular nuclear receptor 4; Testicular receptor 4; TR2R1; TR4; TR4 nuclear hormone receptor
Target Background
This gene encodes a protein that belongs to the nuclear hormone receptor family. Members of this family act as ligand-activated transcription factors and function in many biological processes such as development, cellular differentiation and homeostasis. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. The protein encoded by this gene plays a role in protecting cells from oxidative stress and damage induced by ionizing radiation. The lack of a similar gene in mouse results in growth retardation, severe spinal curvature, subfertility, premature aging, and prostatic intraepithelial neoplasia (PIN) development. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification