Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NUP58 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human NUP58 (NP_054808.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NUP58 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human NUP58 (NP_054808.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06969A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NUP58 |
| Target Synonyms | NUP45; NUPL1; PRO2463; NUP58 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human NUP58 (NP_054808.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AAQLQSIHENVKVLKEQYLGYRKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGPQPSLGVSFGTPFGSGIGTGL | Uniprot ID | Q9BVL2 |
Uniprot Id
Q9BVL2
Target Species
Human
Target Name
NUP58
Target Full Name
Nucleoporin p58/p45
Target Function
Component of the nuclear pore complex, a complex required for the trafficking across the nuclear membrane.
Target Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus membrane; Peripheral membrane protein; Nucleoplasmic side.
Target Protein Families
NUP58 family
Target Synonyms
NUP58; KIAA0410; NUPL1; Nucleoporin p58/p45; 58 kDa nucleoporin; Nucleoporin-like protein 1
Target Background
This gene encodes a member of the nucleoporin family that shares 87% sequence identity with rat nucleoporin p58. The protein is localized to the nuclear rim and is a component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
