Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NXN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human NXN (NP_001192248.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NXN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human NXN (NP_001192248.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02091A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NXN |
| Target Synonyms | NRX; RRS2; TRG-4; NXN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-280 of human NXN (NP_001192248.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CRSLTRVLVESYRKIKEAGQNFEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIMLDPQGEVITRQGRVEVLNDEDCREFPWHPKPVLELSDSNAAQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNL | Uniprot ID | Q6DKJ4 |
Uniprot Id
Q6DKJ4
Target Species
Human
Target Name
NXN
Target Full Name
Nucleoredoxin
Target Function
Functions as a redox-dependent negative regulator of the Wnt signaling pathway, possibly by preventing ubiquitination of DVL3 by the BCR(KLHL12) complex. May also function as a transcriptional regulator act as a regulator of protein phosphatase 2A (PP2A).
Target Subcellular Location
Cytoplasm, cytosol. Nucleus.
Target Protein Families
Nucleoredoxin family
Target Synonyms
FLJ12614; NRX; nucleoredoxin 1; Nucleoredoxin; Nxn; NXN_HUMAN; OTTHUMP00000115356; TRG 4
Target Background
This gene encodes a member of the thioredoxin superfamily, a group of small, multifunctional redox-active proteins. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. The encoded protein acts a redox-dependent regulator of the Wnt signaling pathway and is involved in cell growth and differentiation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
