Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Olig2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-80 of human Olig2 (NP_005797.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Olig2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-80 of human Olig2 (NP_005797.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03255A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | olig2 |
| Target Synonyms | BHLHB1; OLIGO2; RACK17; PRKCBP2; bHLHe19; Olig2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-80 of human Olig2 (NP_005797.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSS | Uniprot ID | Q13516 |
Uniprot Id
Q13516
Target Species
Human
Target Name
OLIG2
Target Full Name
Oligodendrocyte transcription factor 2
Target Function
Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain. Functions together with ZNF488 to promote oligodendrocyte differentiation. Cooperates with OLIG1 to establish the pMN domain of the embryonic neural tube. Antagonist of V2 interneuron and of NKX2-2-induced V3 interneuron development.
Target Involvement
A chromosomal aberration involving OLIG2 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(14;21)(q11.2;q22) with TCRA.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Tissue Specificity
Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas highly variable.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Basic domain helix loop helix protein class B 1; Basic helix loop helix protein class B 1; BHLHB; bHLHB1; bHLHe19; Class B basic helix loop helix protein 1; Class B basic helix-loop-helix protein 1; class E basic helix loop helix protein 19; Class E basic helix-loop-helix protein 19; Human protein kinase C binding protein RACK17; Olig2; OLIG2_HUMAN; Oligo2; Oligodendrocyte lineage transcription factor 2; Oligodendrocyte specific bHLH transcription factor 2; Oligodendrocyte transcription factor 2; OTTHUMP00000067569; OTTHUMP00000067570; PRKCBP2; Protein kinase C binding protein 2; Protein kinase C binding protein RACK17; Protein kinase C-binding protein 2; Protein kinase C-binding protein RACK17; RACK17
Target Background
This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
