Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OXCT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 430-510 of human OXCT2 (NP_071403.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against OXCT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 430-510 of human OXCT2 (NP_071403.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05372A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OXCT2 |
| Target Synonyms | SCOTT; FKSG25; OXCT2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 430-510 of human OXCT2 (NP_071403.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGLTVDDIKKSTGCAFAVSPNLR | Uniprot ID | Q9BYC2 |
Uniprot Id
Q9BYC2
Target Species
Human
Target Name
OXCT2
Target Full Name
Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
Target Function
Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.
Target Subcellular Location
Mitochondrion.
Target Protein Families
3-oxoacid CoA-transferase family
Target Tissue Specificity
Testis specific.
Target Synonyms
OXCT2; FKSG25; Succinyl-CoA:3-ketoacid coenzyme A transferase 2; mitochondrial; EC 2.8.3.5; 3-oxoacid CoA-transferase 2A; Testis-specific succinyl-CoA:3-oxoacid CoA-transferase; SCOT-t
Target Background
The protein encoded by this gene catalyzes the transfer of a CoA group from succinate to acetoacetate and is an important enzyme in ketone body catabolism. The encoded protein localizes to the mitochondrion. This gene is intronless, and a pseudogene of this gene is located elsewhere on chromosome 1.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
