Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Oxytocin Receptor was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-394 of human Oxytocin Receptor (NP_000907.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Oxytocin Receptor was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-394 of human Oxytocin Receptor (NP_000907.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06700A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Oxytocin Receptor |
| Target Synonyms | OTR; OT-R; Oxytocin Receptor | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-394 of human Oxytocin Receptor (NP_000907.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WDANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA | Uniprot ID | P30559 |
Uniprot Id
P30559
Target Species
Human
Target Name
OXTR
Target Full Name
Oxytocin receptor
Target Function
Receptor for oxytocin. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Target Synonyms
OT R; OT-R; OTR 1; OTR; OTR1; OXT R; Oxtr; OXYR_HUMAN; Oxytocin receptor
Target Background
The protein encoded by this gene belongs to the G-protein coupled receptor family and acts as a receptor for oxytocin. Its activity is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. The oxytocin-oxytocin receptor system plays an important role in the uterus during parturition.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
