Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against P2RX4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 111-211 of human P2RX4(NP_002551.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against P2RX4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 111-211 of human P2RX4(NP_002551.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of?U-2 OS cells using?P2RX4 Rabbit pAb(A25044) at?a?dilution of?1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution.?Blue: DAPI for nuclear staining.
| Cat.No | ADA-08371A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | P2RX4 |
| Target Synonyms | P2X4; P2X4R; P2RX4 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 111-211 of human P2RX4(NP_002551.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITT | Uniprot ID | Q99571 |
Uniprot Id
Q99571
Target Species
Human
Target Name
P2RX4
Target Full Name
P2X purinoceptor 4
Target Function
Receptor for ATP that acts as a ligand-gated ion channel. This receptor is insensitive to the antagonists PPADS and suramin.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
P2X receptor family
Target Synonyms
AI504491; ATP gated cation channel protein ; ATP receptor; AW555605; D5Ertd444e ; fi03f02; MGC143034 ; OTTMUSP00000023741; OTTMUSP00000023745; OTTMUSP00000023746; OTTMUSP00000023747; P2rx4; P2RX4_HUMAN; P2X purinoceptor 4; P2X receptor subunit 4; P2X4; P2X4R ; Purinergic receptor; Purinergic receptor P2X ligand gated ion channel 4; Purinergic receptor P2X4 ; Purinoceptor P2X4 ; wu:fi03f02
Target Background
The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS. The product of this gene has the lowest sensitivity for these antagonists. Multiple alternatively spliced transcript variants, some protein-coding and some not protein-coding, have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
