-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against P2RY12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 243-342 of human P2RY12 (NP_795345.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against P2RY12 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 243-342 of human P2RY12 (NP_795345.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04534A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | P2RY12 |
| Target Synonyms | HORK3; P2Y12; ADPG-R; BDPLT8; SP1999; P2T(AC); P2Y(AC); P2Y(12)R; P2Y(ADP); P2Y(cyc); P2RY12 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 243-342 of human P2RY12 (NP_795345.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | Uniprot ID | Q9H244 |
Uniprot Id
Q9H244
Target Species
Human
Target Name
P2RY12
Target Full Name
P2Y purinoceptor 12
Target Function
Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.
Target Involvement
Bleeding disorder, platelet-type 8 (BDPLT8)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Highly expressed in the platelets, lower levels in the brain. Lowest levels in the lung, appendix, pituitary and adrenal gland. Expressed in the spinal cord and in the fetal brain.
Target Synonyms
P2RY12; HORK3; P2Y purinoceptor 12; P2Y12; ADP-glucose receptor; ADPG-R; P2T(AC; P2Y(AC; P2Y(cyc; P2Y12 platelet ADP receptor; P2Y(ADP; SP1999
Target Background
The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelet aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders. Mutations in this gene are implicated in bleeding disorder, platelet type 8 (BDPLT8). Alternative splicing results in multiple transcript variants of this gene.
Notification