-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against P4HA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 239-333 of human P4HA2 (NP_004190.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against P4HA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 239-333 of human P4HA2 (NP_004190.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11228A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | P4HA2 |
| Target Synonyms | MYP25; lncRNA-PE; P4HA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HepG2, Mouse placenta, Rat placenta | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 239-333 of human P4HA2 (NP_004190.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEW | Uniprot ID | O15460 |
Uniprot Id
O15460
Target Species
Human
Target Name
P4HA2
Target Full Name
Prolyl 4-hydroxylase subunit alpha-2
Target Function
Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.
Target Involvement
Myopia 25, autosomal dominant (MYP25)
Target Subcellular Location
Endoplasmic reticulum lumen.
Target Protein Families
P4HA family
Target Synonyms
2-oxoglutarate-4-dioxygenase subunit alpha-2; 4 PH alpha 2; 4-PH alpha-2; C-P4Halpha(II); collagen prolyl 4-hydroxylase alpha(II); P4HA2; P4HA2_HUMAN; procollagen proline, 2 oxoglutarate 4 dioxygenase (proline 4 hydroxylase), alpha polypeptide II; procollagen proline, 2 oxoglutarate 4 dioxygenase alpha subunit, isoform 2; Procollagen-proline; procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-2; Prolyl 4 hydroxylase alpha 2 subunit; Prolyl 4 hydroxylase subunit alpha 2 [Precursor]; Prolyl 4-hydroxylase subunit alpha-2; Prolyl 4-hydroxylase, alpha polypeptide II
Target Background
This gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification