-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against p90Rsk/RSK1/RPS6KA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human p90Rsk/RSK1/RPS6KA1 (Q15418) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against p90Rsk/RSK1/RPS6KA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human p90Rsk/RSK1/RPS6KA1 (Q15418) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16892A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | p90Rsk/RSK1/RPS6KA1 |
| Target Synonyms | RSK; HU-1; RSK1; p90Rsk; MAPKAPK1; MAPKAPK1A; p90Rsk/RSK1/RPS6KA1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p90Rsk/RSK1/RPS6KA1 (Q15418). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKAT | Uniprot ID | Q15418 |
Uniprot Id
Q15418
Target Species
Human
Target Name
RPS6KA1
Target Full Name
Ribosomal protein S6 kinase alpha-1
Target Function
Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of the transcription factors CREB1, ETV1/ER81 and NR4A1/NUR77, regulates translation through RPS6 and EIF4B phosphorylation, and mediates cellular proliferation, survival, and differentiation by modulating mTOR signaling and repressing pro-apoptotic function of BAD and DAPK1. In fibroblast, is required for EGF-stimulated phosphorylation of CREB1, which results in the subsequent transcriptional activation of several immediate-early genes. In response to mitogenic stimulation (EGF and PMA), phosphorylates and activates NR4A1/NUR77 and ETV1/ER81 transcription factors and the cofactor CREBBP. Upon insulin-derived signal, acts indirectly on the transcription regulation of several genes by phosphorylating GSK3B at 'Ser-9' and inhibiting its activity. Phosphorylates RPS6 in response to serum or EGF via an mTOR-independent mechanism and promotes translation initiation by facilitating assembly of the pre-initiation complex. In response to insulin, phosphorylates EIF4B, enhancing EIF4B affinity for the EIF3 complex and stimulating cap-dependent translation. Is involved in the mTOR nutrient-sensing pathway by directly phosphorylating TSC2 at 'Ser-1798', which potently inhibits TSC2 ability to suppress mTOR signaling, and mediates phosphorylation of RPTOR, which regulates mTORC1 activity and may promote rapamycin-sensitive signaling independently of the PI3K/AKT pathway. Mediates cell survival by phosphorylating the pro-apoptotic proteins BAD and DAPK1 and suppressing their pro-apoptotic function. Promotes the survival of hepatic stellate cells by phosphorylating CEBPB in response to the hepatotoxin carbon tetrachloride (CCl4). Mediates induction of hepatocyte prolifration by TGFA through phosphorylation of CEBPB. Is involved in cell cycle regulation by phosphorylating the CDK inhibitor CDKN1B, which promotes CDKN1B association with 14-3-3 proteins and prevents its translocation to the nucleus and inhibition of G1 progression. Phosphorylates EPHA2 at 'Ser-897', the RPS6KA-EPHA2 signaling pathway controls cell migration.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, S6 kinase subfamily
Target Synonyms
90 kDa ribosomal protein S6 kinase 1; dJ590P13.1 (ribosomal protein S6 kinase; 90kD; polypeptide 1; dJ590P13.1; EC 2.7.11.1 ; HU 1; HU1; KS6A1_HUMAN; MAP kinase activated protein kinase 1a; MAP kinase-activated protein kinase 1a; MAPK-activated protein kinase 1a; MAPKAP kinase 1a; MAPKAPK-1a; MAPKAPK1A; MGC79981; Mitogen-activated protein kinase-activated protein kinase 1A; OTTHUMP00000004113 ; p90 RSK1; p90-RSK 1; p90rsk; p90RSK1; p90S6K; pp90RSK1; Ribosomal protein S6 kinase 90kD 1; Ribosomal protein S6 kinase 90kD polypeptide 1; Ribosomal protein S6 kinase 90kDa polypeptide 1; Ribosomal protein S6 kinase alpha 1; Ribosomal protein S6 kinase alpha-1; Ribosomal protein S6 kinase polypeptide 1; Ribosomal S6 kinase 1; RPS6K1 alpha; rps6ka; Rps6ka1; RSK 1; RSK 1 p90; RSK; RSK-1; RSK1; RSK1p90; S6K alpha 1 ; S6K-alpha-1
Target Background
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Notification