-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PABPC4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human PABPC4 (NP_003810.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PABPC4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human PABPC4 (NP_003810.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08685A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PABPC4 |
| Target Synonyms | APP1; APP-1; PABP4; iPABP; PABPC4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, HepG2, Jurkat, Mouse spleen | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PABPC4 (NP_003810.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMP | Uniprot ID | Q13310 |
Uniprot Id
Q13310
Target Species
Human
Target Name
PABPC4
Target Full Name
Polyadenylate-binding protein 4
Target Function
Binds the poly(A) tail of mRNA. May be involved in cytoplasmic regulatory processes of mRNA metabolism. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.
Target Subcellular Location
Cytoplasm. Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
Target Protein Families
Polyadenylate-binding protein type-1 family
Target Tissue Specificity
Expressed at low levels in resting normal T cells; following T-cell activation, however, mRNA levels are rapidly up-regulated.
Target Research Area
Others
Target Synonyms
Activated platelet protein 1; Activated-platelet protein 1; APP 1 ; APP-1; APP1 ; FLJ43938; Inducible poly(A) binding protein; Inducible poly(A)-binding protein; iPABP; IPABP4; PABP 4; PABP-4; PABP4; PABP4_HUMAN; PABPC 4; PABPC4; Poly A binding protein cytoplasmic 4; Poly(A) binding protein 4; Poly(A) binding protein cytoplasmic 4 (inducible form) ; Poly(A) binding protein cytoplasmic 4; Poly(A)-binding protein 4; Polyadenylate binding protein 4; Polyadenylate-binding protein 4; Polyadenylate-binding protein; cytoplasmic; 4; Polyadenylate-binding protein; inducible
Target Background
Poly(A)-binding proteins (PABPs) bind to the poly(A) tail present at the 3-prime ends of most eukaryotic mRNAs. PABPC4 or IPABP (inducible PABP) was isolated as an activation-induced T-cell mRNA encoding a protein. Activation of T cells increased PABPC4 mRNA levels in T cells approximately 5-fold. PABPC4 contains 4 RNA-binding domains and proline-rich C terminus. PABPC4 is localized primarily to the cytoplasm. It is suggested that PABPC4 might be necessary for regulation of stability of labile mRNA species in activated T cells. PABPC4 was also identified as an antigen, APP1 (activated-platelet protein-1), expressed on thrombin-activated rabbit platelets. PABPC4 may also be involved in the regulation of protein translation in platelets and megakaryocytes or may participate in the binding or stabilization of polyadenylates in platelet dense granules. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. This protein has also been found to interact with coronavirus nucleocapsid proteins and is thought to inhibit coronavirus replication.
Notification