-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAFAH2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-350 of human PAFAH2 (NP_000428.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAFAH2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-350 of human PAFAH2 (NP_000428.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04142A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAFAH2 |
| Target Synonyms | HSD-PLA2; PAFAH2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse liver, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 260-350 of human PAFAH2 (NP_000428.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AWMFPLERDFYPKARGPVFFINTEKFQTMESVNLMKKICAQHEQSRIITVLGSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMV | Uniprot ID | Q99487 |
Uniprot Id
Q99487
Target Species
Human
Target Name
PAFAH2
Target Full Name
Platelet-activating factor acetylhydrolase 2, cytoplasmic
Target Function
Catalyzes the hydrolyze of the acetyl group at the sn-2 position of platelet-activating factor (PAF) and its analogs, leading to their inactivation. Hydrolyzes propionyl and butyroyl moieties approximately half as effectively as PAF. Also catalyzes transacetylation of the acetyl group from platelet-activating factor (PAF) to lysoplasmalogen and to sphingosine, producing plasmalogen analogs of PAF and N-acetylsphingosine (C2-ceramide) respectively. Has a marked selectivity for phospholipids with short acyl chains at the sn-2 position.
Target Subcellular Location
Cytoplasm. Membrane; Lipid-anchor. Endoplasmic reticulum membrane; Lipid-anchor.
Target Protein Families
Serine esterase family
Target Tissue Specificity
Broadly expressed in different tissues, but high in B- and T-lymphocytes. In brain, expression is restricted to amygdala and frontal cortex.
Target Synonyms
PAFAH2Platelet-activating factor acetylhydrolase 2; cytoplasmic; EC 3.1.1.47; Serine-dependent phospholipase A2; SD-PLA2; hSD-PLA2
Target Background
This gene encodes platelet-activating factor acetylhydrolase isoform 2, a single-subunit intracellular enzyme that catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). However, this lipase exhibits a broader substrate specificity than simply platelet activating factor. Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist, and both are multi-subunit enzymes. Additionally, there is a single-subunit serum isoform of this enzyme.
Notification