-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAPSS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-260 of human PAPSS1 (NP_005434.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAPSS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-260 of human PAPSS1 (NP_005434.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06046A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAPSS1 |
| Target Synonyms | SK1; PAPSS; ATPSK1; PAPSS1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HT-29, LO2, Mouse brain, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 190-260 of human PAPSS1 (NP_005434.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKIN | Uniprot ID | O43252 |
Uniprot Id
O43252
Target Species
Human
Target Name
PAPSS1
Target Full Name
Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1
Target Function
Bifunctional enzyme with both ATP sulfurylase and APS kinase activity, which mediates two steps in the sulfate activation pathway. The first step is the transfer of a sulfate group to ATP to yield adenosine 5'-phosphosulfate (APS), and the second step is the transfer of a phosphate group from ATP to APS yielding 3'-phosphoadenylylsulfate (PAPS: activated sulfate donor used by sulfotransferase). In mammals, PAPS is the sole source of sulfate; APS appears to be only an intermediate in the sulfate-activation pathway. Required for normal biosynthesis of sulfated L-selectin ligands in endothelial cells.
Target Protein Families
APS kinase family; Sulfate adenylyltransferase family
Target Tissue Specificity
Expressed in testis, pancreas, kidney, thymus, prostate, ovary, small intestine, colon, leukocytes and liver. Also expressed in high endothelial venules (HEV) cells and in cartilage.
Target Synonyms
3 prime phosphoadenosine 5 prime phosphosulfate synthase 1; 3' phosphoadenosine 5' phosphosulfate synthase 1; 3''-phosphoadenosine-5''-phosphosulfate synthase; Adenosine-5''-phosphosulfate 3''-phosphotransferase; Adenylyl-sulfate kinase; Adenylylsulfate 3''-phosphotransferase; APS kinase; ATP-sulfurylase; ATPSK 1; ATPSK1; ATPSK2; Bifunctional 3' phosphoadenosine 5' phosphosulfate synthetase 1; PAPS synthase 1; PAPS synthetase 1; PAPS1_HUMAN; PAPSS 1; PAPSS; PAPSS1; SAT; SK 1; SK1; SK2; Sulfate adenylate transferase; Sulfurylase kinase 1
Target Background
Three-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) is the sulfate donor cosubstrate for all sulfotransferase (SULT) enzymes (Xu et al., 2000 [PubMed 10679223]). SULTs catalyze the sulfate conjugation of many endogenous and exogenous compounds, including drugs and other xenobiotics. In humans, PAPS is synthesized from adenosine 5-prime triphosphate (ATP) and inorganic sulfate by 2 isoforms, PAPSS1 and PAPSS2 (MIM 603005).
Notification