-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PATZ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human PATZ1 (NP_055138.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PATZ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human PATZ1 (NP_055138.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01221A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PATZ1 |
| Target Synonyms | ZSG; MAZR; PATZ; RIAZ; ZBTB19; ZNF278; dJ400N23; PATZ1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-549, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human PATZ1 (NP_055138.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PFPSVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSR | Uniprot ID | Q9HBE1 |
Uniprot Id
Q9HBE1
Target Species
Human
Target Name
PATZ1
Target Full Name
POZ-, AT hook-, and zinc finger-containing protein 1
Target Function
Transcriptional regulator that plays a role in many biological processes such as embryogenesis, senescence, T-cell development or neurogenesis. Interacts with the TP53 protein to control genes that are important in proliferation and in the DNA-damage response. Mechanistically, the interaction inhibits the DNA binding and transcriptional activity of TP53/p53. Part of the transcriptional network modulating regulatory T-cell development and controls the generation of the regulatory T-cell pool under homeostatic conditions.; (Microbial infection) Plays a positive role in viral cDNA synthesis.
Target Involvement
A chromosomal aberration involving PATZ1 is associated with small round cell sarcoma. Translocation t(1;22)(p36.1;q12) with EWSR1.
Target Subcellular Location
Nucleus.
Target Protein Families
Krueppel C2H2-type zinc-finger protein family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
8430401L15Rik; AI447519; and zinc finger-containing protein 1; AT hook-; BTB POZ domain zinc finger transcription factor; BTB/POZ domain zinc finger transcription factor; dJ400N23; Mazr; PATZ ; PATZ1; PATZ1_HUMAN; POZ (BTB) and AT hook containing zinc finger 1; POZ , AT hook, and zinc finger containing protein 1; POZ-; Protein kinase A RI subunit alpha associated protein; Protein kinase A RI subunit alpha-associated protein; RIAZ; Transcription factor MAZR ; ZBTB19; Zfp278; Zinc finger and BTB domain containing protein 19 ; Zinc finger and BTB domain-containing protein 19; Zinc finger protein 278; Zinc finger protein 278, isoform CRA_d; Zinc finger sarcoma gene protein; ZNF278; ZSG
Target Background
The protein encoded by this gene contains an A-T hook DNA binding motif which usually binds to other DNA binding structures to play an important role in chromatin modeling and transcription regulation. Its Poz domain is thought to function as a site for protein-protein interaction and is required for transcriptional repression, and the zinc-fingers comprise the DNA binding domain. Since the encoded protein has typical features of a transcription factor, it is postulated to be a repressor of gene expression. In small round cell sarcoma, this gene is fused to EWS by a small inversion of 22q, then the hybrid is thought to be translocated (t(1;22)(p36.1;q12). The rearrangement of chromosome 22 involves intron 8 of EWS and exon 1 of this gene creating a chimeric sequence containing the transactivation domain of EWS fused to zinc finger domain of this protein. This is a distinct example of an intra-chromosomal rearrangement of chromosome 22. Four alternatively spliced transcript variants are described for this gene.
Notification