Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human PAX1 (NP_006183.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human PAX1 (NP_006183.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with PAX1 using PAX1 Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-06910A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAX1 |
| Target Synonyms | OFC2; HUP48; PAX1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T transfected with PAX1 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PAX1 (NP_006183.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TFMEQTGALAGSEGTAYSPKMEDWAGVNRTAFPATPAVNGLEKPALEADIKYTQSASTLSAVGGFLPACAYPASNQHGVYSAPGGGYLAPGPPWPPAQGPP | Uniprot ID | P15863 |
Uniprot Id
P15863
Target Species
Human
Target Name
PAX1
Target Full Name
Paired box protein Pax-1
Target Function
This protein is a transcriptional activator. It may play a role in the formation of segmented structures of the embryo. May play an important role in the normal development of the vertebral column.
Target Involvement
Otofaciocervical syndrome 2 (OTFCS2)
Target Subcellular Location
Nucleus.
Target Synonyms
HUP48; OTTHUMP00000030407; Paired box 1; Paired box gene 1; Paired box protein Pax 1; Paired box protein Pax-1; Paired domain gene HuP48; PAX 1; Pax1; PAX1_HUMAN
Target Background
This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. This gene plays a role in pattern formation during embryogenesis and may be essential for development of the vertebral column. This gene is silenced by methylation in ovarian and cervical cancers and may be a tumor suppressor gene. Mutations in this gene are also associated with vertebral malformations.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
