-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAX7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human PAX7 (P23759) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAX7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human PAX7 (P23759) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13827A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAX7 |
| Target Synonyms | HUP1; RMS2; PAX7B; CMYP19; MYOSCO; PAX7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, C2C12, MCF7, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PAX7 (P23759). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SAYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT | Uniprot ID | P23759 |
Uniprot Id
P23759
Target Species
Human
Target Name
PAX7
Target Full Name
Paired box protein Pax-7
Target Function
Transcription factor that is involved in the regulation of muscle stem cells proliferation, playing a role in myogenesis and muscle regeneration.
Target Involvement
Rhabdomyosarcoma 2 (RMS2)
Target Subcellular Location
Nucleus.
Target Protein Families
Paired homeobox family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
FLJ37460; HUP1; OTTHUMP00000002534 ; Paired box 7; Paired box gene 7; Paired box homeotic gene 7; Paired box protein Pax-7; Paired domain gene 7; Paired domain gene HuP1; Pax7; PAX7 transcriptional factor ; PAX7/FKHR fusion gene, included; PAX7_HUMAN; PAX7B; RGD1564360; RMS2
Target Background
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene.
Notification