-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PBX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human PBX1 (NP_002576.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PBX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human PBX1 (NP_002576.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10412A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PBX1 |
| Target Synonyms | CAKUHED; PBX1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat testis, SKOV3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human PBX1 (NP_002576.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSV | Uniprot ID | P40424 |
Uniprot Id
P40424
Target Species
Human
Target Name
PBX1
Target Full Name
Pre-B-cell leukemia transcription factor 1
Target Function
Transcription factor which binds the DNA sequence 5'-TGATTGAT-3' as part of a heterodimer with HOX proteins such as HOXA1, HOXA5, HOXB7 and HOXB8. Binds to the DNA sequence 5'-TGATTGAC-3' in complex with a nuclear factor which is not a class I HOX protein. Has also been shown to bind the DNA sequence 5'-ATCAATCAA-3' cooperatively with HOXA5, HOXB7, HOXB8, HOXC8 and HOXD4. Acts as a transcriptional activator of PF4 in complex with MEIS1. Also activates transcription of SOX3 in complex with MEIS1 by binding to the 5'-TGATTGAC-3' consensus sequence. In natural killer cells, binds to the NFIL3 promoter and acts as a transcriptional activator of NFIL3, promoting natural killer cell development. Plays a role in the cAMP-dependent regulation of CYP17A1 gene expression via its cAMP-regulatory sequence (CRS1). Probably in complex with MEIS2, involved in transcriptional regulation by KLF4. Acts as a transcriptional activator of NKX2-5 and a transcriptional repressor of CDKN2B. Together with NKX2-5, required for spleen development through a mechanism that involves CDKN2B repression.; As part of a PDX1:PBX1b:MEIS2B complex in pancreatic acinar cells, is involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element.
Target Involvement
Congenital anomalies of kidney and urinary tract syndrome with or without hearing loss, abnormal ears, or developmental delay (CAKUTHED)
Target Subcellular Location
Nucleus.
Target Protein Families
TALE/PBX homeobox family
Target Tissue Specificity
Expressed in the kidney. Expressed in the endothelial cells of the glomeruli and interstitium (at protein level). Expressed in all tissues except in cells of the B and T lineage. Expressed strongly in kidney and brain.
Target Synonyms
DKFZp686B09108; Homeo box protein PBX1; Homeo box protein PRL; Homeobox protein PBX 1; Homeobox protein PBX1; Homeobox protein PRL; MGC126627; PBX 1; Pbx1; PBX1_HUMAN; Pre B cell leukemia homeobox 1; Pre B cell leukemia transcription factor 1; Pre-B-cell leukemia transcription factor 1; PRL
Target Background
This gene encodes a nuclear protein that belongs to the PBX homeobox family of transcriptional factors. Studies in mice suggest that this gene may be involved in the regulation of osteogenesis and required for skeletal patterning and programming. A chromosomal translocation, t(1;19) involving this gene and TCF3/E2A gene, is associated with pre-B-cell acute lymphoblastic leukemia. The resulting fusion protein, in which the DNA binding domain of E2A is replaced by the DNA binding domain of this protein, transforms cells by constitutively activating transcription of genes regulated by the PBX protein family. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification