-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PCDHGA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-360 of human PCDHGA1 (NP_114382.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PCDHGA1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-360 of human PCDHGA1 (NP_114382.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03501A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PCDHGA1 |
| Target Synonyms | PCDH-GAMMA-A1; PCDHGA1 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 240-360 of human PCDHGA1 (NP_114382.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PAFTQAQYHINVPENVPLGTQLLMVNATDPDEGANGEVTYSFHNVDHRVAQIFRLDSYTGEISNKEPLDFEEYKMYSMEVQAQDGAGLMAKVKVLIKVLDVNDNAPEVTITSVTTAVPENF | Uniprot ID | Q9Y5H4 |
Uniprot Id
Q9Y5H4
Target Species
Human
Target Name
PCDHGA1
Target Full Name
Protocadherin gamma-A1
Target Function
Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Synonyms
Gamma Protocadherin (pan); Pan-Gamma-Protocadherin; PCDG1_HUMAN; PCDH gamma A1 ; PCDH-gamma-A1; PCDHGA1; Protocadherin gamma A1; Protocadherin gamma subfamily A, 1; Protocadherin gamma, subfamily A, member 1; Protocadherin gamma-A1
Target Background
This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.
Notification