Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDE4B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 636-736 of human PDE4B (NP_002591.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDE4B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 636-736 of human PDE4B (NP_002591.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08086A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDE4B |
| Target Synonyms | DPDE4; PDEIVB; PDE4B | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 636-736 of human PDE4B (NP_002591.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT | Uniprot ID | Q07343 |
Uniprot Id
Q07343
Target Species
Human
Target Name
PDE4B
Target Full Name
3',5'-cyclic-AMP phosphodiesterase 4B
Target Function
Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in mediating central nervous system effects of therapeutic agents ranging from antidepressants to antiasthmatic and anti-inflammatory agents.
Target Protein Families
Cyclic nucleotide phosphodiesterase family, PDE4 subfamily
Target Tissue Specificity
Expressed in brain, heart, lung and skeletal muscle.
Target Synonyms
DPDE4; PDEIVB; PDE4B
Target Background
This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. The encoded protein regulates the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
