Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDGFRL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 15-205 of human PDGFRL (NP_006198.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDGFRL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 15-205 of human PDGFRL (NP_006198.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01034A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDGFRL |
| Target Synonyms | PDGRL; PRLTS; PDGFRL | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, NCI-H125 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 15-205 of human PDGFRL (NP_006198.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQVLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVKQNERYGQLTLVNSTSADTGEFSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAKV | Uniprot ID | Q15198 |
Uniprot Id
Q15198
Target Species
Human
Target Name
PDGFRL
Target Full Name
Platelet-derived growth factor receptor-like protein
Target Involvement
Colorectal cancer (CRC)
Target Subcellular Location
Secreted.
Target Tissue Specificity
Expressed in colon, lung and liver.
Target Synonyms
PDGF receptor beta like tumor suppressor ; PDGF receptor beta-like tumor suppressor; PDGFR-like protein; Pdgfrl; PDGRL; PGFRL_HUMAN; Platelet-derived growth factor receptor-like protein; PRLTS
Target Background
This gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic hepatocellular carcinomas, colorectal cancers, and non-small cell lung cancers. This suggests this gene product may function as a tumor suppressor.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
