-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDLIM1/CLP36 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PDLIM1/CLP36 (O00151) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PDLIM1/CLP36 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PDLIM1/CLP36 (O00151) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14382A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDLIM1/CLP36 |
| Target Synonyms | CLIM1; CLP36; CLP-36; hCLIM1; HEL-S-112; PDLIM1/CLP36 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Mouse thymus, THP-1 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PDLIM1/CLP36 (O00151). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQEKQELNEPPKQSTSFLVLQEILESEEKGDPNKPSGFRSVKAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCTDCGTNLKQKGHFF | Uniprot ID | O00151 |
Uniprot Id
O00151
Target Species
Human
Target Name
PDLIM1
Target Full Name
PDZ and LIM domain protein 1
Target Function
Cytoskeletal protein that may act as an adapter that brings other proteins (like kinases) to the cytoskeleton. Involved in assembly, disassembly and directioning of stress fibers in fibroblasts. Required for the localization of ACTN1 and PALLD to stress fibers. Required for cell migration and in maintaining cell polarity of fibroblasts.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cytoplasm, myofibril, sarcomere, Z line.
Target Tissue Specificity
Strongly expressed in the heart and skeletal muscle, moderately expressed in the spleen, small intestine, colon, placenta, and lung. A lower level expression is seen in liver, thymus, kidney, prostate and pancreas and is not found in the brain, testis, ov
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
C terminal LIM domain protein 1; C-terminal LIM domain protein 1; Carboxy terminal LIM domain protein 1; CLIM 1; CLIM1; CLP 36; CLP36; Elfin; Enigma; Enigma homolog; hCLIM 1; hCLIM1; LIM domain protein CLP 36; LIM domain protein CLP-36; LIM domain protein CLP36; PDLI1_HUMAN; PDLIM 1; Pdlim1; PDZ and LIM domain 1; PDZ and LIM domain protein 1
Target Background
This gene encodes a member of the enigma protein family. The protein contains two protein interacting domains, a PDZ domain at the amino terminal end and one to three LIM domains at the carboxyl terminal. It is a cytoplasmic protein associated with the cytoskeleton. The protein may function as an adapter to bring other LIM-interacting proteins to the cytoskeleton. Pseudogenes associated with this gene are located on chromosomes 3, 14 and 17.
Notification