-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Peroxiredoxin 5 (PRDX5) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 53-214 of human Peroxiredoxin 5 (PRDX5) (NP_036226.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Peroxiredoxin 5 (PRDX5) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 53-214 of human Peroxiredoxin 5 (PRDX5) (NP_036226.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09503A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Peroxiredoxin 5 (PRDX5) |
| Target Synonyms | PLP; ACR1; B166; PRXV; PMP20; PRDX6; prx-V; SBBI10; AOEB166; HEL-S-55; Peroxiredoxin 5 (PRDX5) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse lung, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 53-214 of human Peroxiredoxin 5 (PRDX5) (NP_036226.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL | Uniprot ID | P30044 |
Uniprot Id
P30044
Target Species
Human
Target Name
PRDX5
Target Full Name
Peroxiredoxin-5, mitochondrial
Target Function
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events.
Target Subcellular Location
[Isoform Mitochondrial]: Mitochondrion.; [Isoform Cytoplasmic+peroxisomal]: Cytoplasm. Peroxisome matrix.
Target Protein Families
Peroxiredoxin family, Prx5 subfamily
Target Tissue Specificity
Widely expressed.
Target Synonyms
ACR1; Alu co repressor 1; Alu corepressor 1; Antioxidant enzyme B166; AOEB166; B166; epididymis secretory protein Li 55; HEL-S-55; Liver tissue 2D-page spot 71B; mitochondrial; Peroxiredoxin 5; mitochondrial; Peroxiredoxin V; Peroxiredoxin-5; Peroxisomal antioxidant enzyme; PLP; PMP20; PRDX 5; PRDX5; PRDX5_HUMAN; PRDX6; Prx-V; PRXV; SBBI10; Thioredoxin peroxidase PMP20; Thioredoxin reductase; TPx type VI
Target Background
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. The use of alternate transcription start sites is thought to result in transcript variants that use different in-frame translational start codons to generate isoforms that are targeted to the mitochondrion (isoform L) or peroxisome/cytoplasm (isoform S). Multiple related pseudogenes have been defined for this gene.
Notification