-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PFKFB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-220 of human PFKFB3 (NP_004557.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PFKFB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-220 of human PFKFB3 (NP_004557.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12109A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PFKFB3 |
| Target Synonyms | PFK2; IPFK2; iPFK-2; PFKFB3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HCT116, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-220 of human PFKFB3 (NP_004557.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGR | Uniprot ID | Q16875 |
Uniprot Id
Q16875
Target Species
Human
Target Name
PFKFB3
Target Full Name
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
Target Function
Synthesis and degradation of fructose 2,6-bisphosphate.
Target Protein Families
Phosphoglycerate mutase family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
6 phosphofructo 2 kinase/ fructose 2,6 bisphosphatase; 6 phosphofructo 2 kinase/fructose 2,6 biphosphatase 3; 6-bisphosphatase; 6-P2ase 3; 6-P2ASE brain/placenta-type isozyme; 6PF 2 K/Fru 2,6 P2ASE brain/placenta type isozyme; 6PF 2-K/Fru 2,6 P2ase 3; 6PF-2-K/Fru-2; F263_HUMAN; fructose 6 phosphate,2 kinase/fructose 2; 6 bisphosphatase; Fructose-2; Inducible 6 phosphofructo 2 kinase/fructose 2,6 bisphosphatase; iPFK 2; iPFK-2; IPFK2; PFK/FBPase 3; PFK2; PFKFB3; Renal carcinoma antigen NY REN 56; Renal carcinoma antigen NY-REN-56; uPFK
Target Background
The protein encoded by this gene belongs to a family of bifunctional proteins that are involved in both the synthesis and degradation of fructose-2, 6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2, 6-bisphosphate (F2, 6BP), and a fructose-2, 6-biphosphatase activity that catalyzes the degradation of F2, 6BP. This protein is required for cell cycle progression and prevention of apoptosis. It functions as a regulator of cyclin-dependent kinase 1, linking glucose metabolism to cell proliferation and survival in tumor cells. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification